Gene Mb0973c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | chorismate mutase |
| Comments | Mb0973c, -, len: 105 aa. Equivalent to Rv0948c,len: 105 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 105 aa overlap). Conserved hypothetical protein, equivalent to NP_301237.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (105 aa). Also similar (except in N-terminus) to SCD63.16c|CAB82023.1|AL161755 hypothetical protein from Streptomyces coelicolor (110 aa); and to N-terminus of two chorismate mutase/prephenate dehydratase. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1058113 | 1058430 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0973c|Mb0973c
MRPEPPHHENAELAAMNLEMLESQPVPEIDTLREEIDRLDAEILALVKRRAEVSKAIGKARMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH
Bibliography
No article yet recorded