Gene Mb0984A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB9 |
| Comments | Mb0984A, len: 73 aa. Equivalent to Rv0959A len: 73 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 73 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Possible vapB9,antitoxin, part of toxin-antitoxin (TA) operon with Rv0960 (See Arcus et al., 2005; Pandey and Gerdes, 2005). Weakly similar to others in Mycobacterium tuberculosis e.g. Rv1721c |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1073766 | 1073987 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0984A|vapB9
MKTLYLRNVPDDVVERLERLAELAKTSVSAVAVRELTEASRRADNPALLGDLPDIGIDTTELIGGIDAERAGR
Bibliography
No article yet recorded