Gene Mb0985
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc9 |
| Comments | Mb0985, -, len: 127 aa. Equivalent to Rv0960, len: 127 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 127 aa overlap). Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. Rv0065|MTV030.08 (133 aa),FASTA scores: E(): 1.5e-14, (38.3% identity in 128 aa overlap), Rv1720c (129 aa), and Rv0549c (137 aa). |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1073984 | 1074367 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0985|vapc9
MIVVDASAALAALLNDGQARQLIAAERLHVPHLVDSEIASGLRRLAQRDRLGAADGRRALQTWRRLAVTRYPVVGLFERIWEIRANLSAYDASYVALAEALNCALVTADLRLSDTGQAQCPITVVPR
Bibliography
No article yet recorded