Gene Mb0993
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb0993, -, len: 98 aa. Equivalent to Rv0968, len: 98 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 98 aa overlap). Conserved hypothetical protein, similar to NP_301579.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (92 aa). Also highly similar to CONSERVED HYPOTHETICAL PROTEINS from Mycobacterium tuberculosis e.g. Rv3269 (93 aa), FASTA score: (51.1% identity in 94 aa overlap); and Rv1993c (90 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1078830 | 1079126 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0993|Mb0993
MVWHGFLAKAVPTVVTGAVGVAAYEALRKMVVKAPLRAATVSVAAWGIRLAREAERKAGESAEQARLMFADVLAEASERAGEEVPPLAVAGSDDGHDH
Bibliography
No article yet recorded