Gene Mb1005
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l32 rpmf |
| Comments | Mb1005, rpmF, len: 57 aa. Equivalent to Rv0979A,len: 57 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 57 aa overlap). Probable rpmF, 50S ribosomal protein L32, similar to others e.g. rpmF|Q9RL50 PROBABLE 50S RIBOSOMAL PROTEIN from Streptomyces coelicolor (56 aa), FASTA scores: E(): 5.1e-09, (63.45% identity in 52 aa overlap); etc. BELONGS TO THE L32P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1095337 | 1095510 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1005|rpmF
MAVPKRRKSRSNTRSRRSQWKAAKTELVGVTVAGHAHKVPRRLLKAARLGLIDFDKR
Bibliography
No article yet recorded