Gene Mb1011c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE LARGE-CONDUCTANCE ION MECHANOSENSITIVE CHANNEL MSCL |
| Comments | Mb1011c, mscL, len: 151 aa. Equivalent to Rv0985c,len: 151 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 151 aa overlap). Possible mscL, large conductance mechanosensitive ion channel (integral membrane protein), equivalent to AL035500|MLCL373_19|NP_301254.1|NC_002677 putative mechanosensitive channel protein from Mycobacterium leprae (154 aa), FASTA score: (71.0% identity in 155 aa overlap). Also highly similar to others e.g. NP_268999.1|NC_002737 putative large conductance mechanosensitive channel from Streptococcus pyogenes (120 aa); CAB90974.1|AL355832 putative mechanosensitive channel from Streptomyces coelicolor (156 aa); Q9X722|MSCL_CLOHI LARGE-CONDUCTANCE MECHANOSENSITIVE CHANNEL from Clostridium histolyticum (133 aa); Z83337|BSZ83337_6 large conductance mechanosensitive channel from Bacillus subtilis (130 aa),FASTA scores: opt: 248, E(): 8.4e-10, (39.0% identity in 136 aa overlap); U08371|ECU08371_1 large conductance mechanosensitive channel from Escherichia coli strain K-12 (136 aa), FASTA score: (36.6% identity in 134 aa overlap); etc. BELONGS TO THE MSCL FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1101476 | 1101931 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1011c|mscL
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ
Bibliography
No article yet recorded