Gene Mb1038
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase ISPE (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) |
| Comments | Mb1038, ispE, len: 306 aa. Equivalent to Rv1011,len: 306 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 306 aa overlap). Probable ispE,4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.-), similar to others e.g. Q9K3R6|ISPE_STRCO Streptomyces coelicolor (299 aa), FASTA scores: opt: 925,E(): 2.7e-49, (54.5% identity in 297 overlap); etc. BELONGS TO THE ISPE FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1130642 | 1131562 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1038|ispE
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEGADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLLTSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARALRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVVSAPTEV
Bibliography
No article yet recorded