Gene Mb1044c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable conserved lipoprotein lpqt |
Comments | Mb1044c, lpqT, len: 252 aa. Equivalent to 5' end of Rv1016c, len: 226 aa, from Mycobacterium tuberculosis strain H37Rv, (98.9% identity in 190 aa overlap). Probable lpqT, conserved lipoprotein. Similar to several M. tuberculosis hypothetical proteins e.g. Rv0040c|Y0H3_MYCTU|P71697 Proline rich 28 kDA antigen (310 aa), FASTA scores: opt: 329, E(): 2e-17, (32.3% identity in 229 aa overlap); Rv0583c. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a frameshift due to a 5 bp deletion (cacgc-*) leads to a longer product with a different COOH part compared to its homolog in Mycobacterium tuberculosis strain H37Rv. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1135154 | 1135912 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1044c|lpqT MAGRRCPQDSVRPLAVAVAVATLAMSAVACGPKSPDFQSILSTSPTTSAVSTTTEVPVPLWKYLESVGVTGEPVAPSSLTDLTVSIPTPPGWAPMKNPNITPNTEMIAKGESYPTAMLMVFKLHRDFDIAEALKHGTADARLSTNFTELDSSTADFNGFPSSMIQGSYDLHGRRLHTWNRIVFPTGAGQAALPGAAHHHESGQRGRQARFRHRGDHRRIRRRGKVIVRTVGAQLSEQLTRIEFPQCSSHGLA
Bibliography
No article yet recorded