Gene Mb1053
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1053, -, len: 155 aa. Equivalent to Rv1025, len: 155 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 155 aa overlap). Conserved hypothetical protein, similar to AE001768|AE001768_4 hypothetical protein from Thermotoga maritima (170 aa), FASTA scores: opt: 254, E(): 9.5e-10, (35.7% identity in 143 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1147008 | 1147475 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1053|Mb1053
MVTRQLGRAPRGVLAIAYRCPNGEPGVVKTAPRLPDGTPFPTLYYLTHPVLTAAASRLETTGLMREMNRRLGQDAELAAAYRRAHESYLSERDALEPLGTTVSAGGMPDRVKCLHVLIAHSLAKGPGLNPFGDEALALLAAEPRTAATLVAGQWR
Bibliography
No article yet recorded