Gene Mb1060
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable Potassium-transporting ATPase C chain KDPC (Potassium-translocating ATPase C chain) (ATP phosphohydrolase [potassium-transporting] C chain) (Potassium binding and translocating subunit C) |
| Comments | Mb1060, kdpC, len: 189 aa. Equivalent to Rv1031,len: 189 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 189 aa overlap). Probable kdpC,potassium-transporting ATPase C chain (membrane protein) (EC 3.6.3.12), similar to others e.g. ATKC_ECOLI|P03961 potassium-transporting ATPase C chain from Escherichia coli strain K12 (190 aa), FASTA scores: opt: 475, E(): 3.1e-24, (45.7% identity in 186 aa overlap); etc. BELONGS TO THE KDPC FAMILY. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1156300 | 1156869 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1060|kdpC
MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAAASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLIEDHTDARGLGFLGERAVNVLRLNLALDRL
Bibliography
No article yet recorded