Gene Mb1071c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable is like-2 transposase |
| Comments | Mb1071c, -, len: 135 aa. Equivalent to Rv1042c,len: 135 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 135 aa overlap). Probable IS like-2 transposase, similar to Q50761 TRANSPOSASE from Mycobacterium tuberculosis (308 aa), FASTA scores: opt: 823, E(): 0, (99.1% identity in 117 aa overlap). Second copy is Rv1149. |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1165539 | 1165946 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1071c|Mb1071c
MTRVGVISDEFWAVVEPLMPSHEGKPGRRFSDHRLILEGIAWRFRTGSPWRDLPAEFGPWQTVWKRHHRWSLDGTCDEVFAHVAAVFGVDAEVAEDIEKLLSVDSTNVRAHQHSAGACSDTLATGGTVELQEIRR
Bibliography
No article yet recorded