Gene Mb1085
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb1085, -, len: 254 aa. Equivalent to Rv1056, len: 254 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 254 aa overlap). Conserved hypothetical protein, some similarity in C-terminal region of Rv0140|MTCI5.14|Z92770 Mycobacterium tuberculosis (126 aa), FASTA scores: opt: 254, E(): 1.2e-10, (43.4% identity in 106 aa overlap); and to Rv1670. C-terminal region is similar to AL035569|SC8D9.02 hypothetical protein from Streptomyces coelicolor (113 aa), FASTA scores: opt: 282,E(): 4.5e-12, (48.0% identity in 100 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1178076 | 1178840 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1085|Mb1085 MSVDYPQMAATRGRIEPAPRRVRGYLGHVLVFDTSAARYVWEVPYYPQYYIPLADVRMEFLRDENHPQRVQLGPSRLHSLVSAGQTHRSAARVFDVDGDSPVAGTVRFNWDPLRWFEEDEPIYGHPRNPYQRADALRSHRHVRVELDGIVLADTRSPVLLFETGIPTRYYIDPADIAFEHLEPTSTQTLCPYKGTTSGYWSVRVGDAVHRDLAWTYHYPLPAVAPIAGLVAFYNEKVDLTVDGVALPRPHTQFS
Bibliography
No article yet recorded