Gene Mb1093c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible lipoprotein lpqv |
| Comments | Mb1093c, lpqV, len: 139 aa. Equivalent to Rv1064c,len: 139 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 139 aa overlap). Putative lipoprotein LpqV. Has N-terminal signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1187352 | 1187771 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1093c|lpqV
MRPSRYAPLLCAMVLALAWLSAVAGCSRGGSSKAGRSSSVAGTLPAGVVGVSPAGVTTRVDAPAESTEEEYYQACHAARLWMDAQPGSGESLIEPYLAVVQASPSGVAGSWHIRWAALTPARQAAVIVAARAAANAECG
Bibliography
No article yet recorded