Gene Mb1105
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible lipase lipu |
| Comments | Mb1105, lipU, len: 297 aa. Equivalent to Rv1076,len: 297 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 297 aa overlap). Putative lipU, lipase (EC 3.1.-.-), very similar to several Mycobacterium tuberculosis proteins e.g. Z95390|Rv3487c|MTCY13E12.41c (277 aa), FASTA scores: opt: 1225, E(): 0, (76.0% identity in 246 aa overlap); Rv1426c, etc. Also similar to esterases and lipases of around 300 aa e.g. Q44087 ESTERASE PRECURSOR from Acinetobacter lwoffii esterase (303), FASTA scores: opt: 427, E(): 1.9e-21, (32.5% identity in 280 aa overlap). Equivalent to AL035159|MLCB1450 _7 Mycobacterium leprae (335 aa), FASTA scores: opt: 1588, E(): 0, (79.7% identity in 296 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1202127 | 1203020 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1105|lipU
MAVRPVLAVGSYLPHAPWPWGVIDQAARVLLPASTTVRAAVSLPNASAQLVRASGVLPADGTRRAVLYLHGGAFLTCGANSHGRLVELLSKFADSPVLVVDYRLIPKHSIGMALDDCHDGYRWLRLLGYEPEQIVLAGDSAGGYLALALAQRLQEVGEEPAALVAISPLLQLAKEHKQAHPNIKTDAMFPARAFDALDALVASAAARNQVDGEPEELYEPLEHITPGLPRTLIHVSGSEVLLHDAQLAAAKLAAAGVPAEVRVWPGQVHDFQVAASMLPEAIRSLRQIGEYIREATG
Bibliography
No article yet recorded