Gene Mb1107
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable Proline-rich antigen homolog pra |
| Comments | Mb1107, pra, len: 240 aa. Equivalent to Rv1078,len: 240 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 240 aa overlap). Probable pra,Proline-rich antigen homolog, equivalent to X65546|MLPRAG_1 proline rich antigen from Mycobacterium leprae (249 aa), FASTA scores: opt: 1162, E(): 3.3e-30,(64.8% identity in 253 aa overlap). Has potential hydrophobic domains. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1204673 | 1205395 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1107|pra
MTEQPPPGGSYPPPPPPPGPSGGHEPPPAAPPGGSGYAPPPPPSSGSGYPPPPPPPGGGAYPPPPPSAGGYAPPPPGPAIRTMPTESYTPWITRVLAAFIDWAPYVVLVGIGWVIMLVTQTSSCVTSISEYDVGQFCVSQPSMIGQLVQWLLSVGGLAYLVWNYGYRQGTTGSSIGKSVLKFKVVSETTGQPIGFGMSVVRQLAHFIDAIICFVGFLFPLWDAKRQTLADKIMTTVCVPI
Bibliography
No article yet recorded