Gene Mb1118
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | pe family protein pe10 |
Comments | Mb1118, PE10, len: 101 aa. Equivalent to Rv1089,len: 120 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 101 aa overlap). Member of the Mycobacterium tuberculosis PE family of glycine-rich proteins. Partial ORF that appears to be frameshifted,continuation of Rv1088|MTV017.41. Sequence has been checked and appears correct. Similar to Z95555|MTCY06F7_4 Mycobacterium tuberculosis cosmid (401 aa), FASTA scores: opt: 126, E(): 2, (29.6% identity in 125 aa overlap). |
Functional category | Pe/ppe |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1216207 | 1216512 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1118|PE10 MRGAVNAVAGQVTGNGGSGNSGTSAAAANPNSDNTASIADRGTSAIMTTASATASSTGVDGGIAATYAVASQWDGGYVANYTITQFGRDFDDRLAVAIHFA
Bibliography
No article yet recorded