Gene Mb1132c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | toxin mazf3 |
| Comments | Mb1132c, -, len: 103 aa. Equivalent to Rv1102c,len: 103 aa, from Mycobacterium tuberculosis strain H37Rv,(99.0% identity in 103 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical protens e.g. Rv1942c|MTCY9F9_22 (109 aa),FASTA scores: opt: 158, E(): 3.6e-05, (33.3% identity in 93 aa overlap); Rv0659c|MTCI376_17 (102aa), opt: 140, E(): 0.00072, (40.6% identity in 69aa overlap); and Rv1495. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1232031 | 1232342 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1132c|mazf3
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYLLASQEPALAEAIGNAFDLDWVVA
Bibliography
No article yet recorded