Gene Mb1133c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin maze3 |
| Comments | Mb1133c, -, len: 106 aa. Equivalent to Rv1103c,len: 106 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 106 aa overlap). Conserved hypothetical protein, similar to part of Mycobacterium tuberculosis hypothetical protein Rv2472|AL021246|MTV008_27 Mycobacterium tuberculosis (97 aa), FASTA score: opt: 135,E(): 0.0091, (45.8% identity in 72 aa overlap). TBparse score is 0.916. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1232342 | 1232662 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1133c|maze3
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEILATNTSATGDLDTLAGHCARTALDID
Bibliography
No article yet recorded