Gene Mb1144
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc32. contains pin domain. |
| Comments | Mb1144, -, len: 124 aa. Equivalent to Rv1114, len: 124 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 124 aa overlap). Conserved hypothetical protein, slight similarity to Mycobacterium tuberculosis hypothetical proteins MTCY159.08c (33.0% identity in 115 aa overlap); Rv1561 and Rv2010. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1240981 | 1241355 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1144|vapc32
MILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGRGLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Bibliography
No article yet recorded