Gene Mb1144 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | possible toxin vapc32. contains pin domain. | 
| Comments | Mb1144, -, len: 124 aa. Equivalent to Rv1114, len: 124 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 124 aa overlap). Conserved hypothetical protein, slight similarity to Mycobacterium tuberculosis hypothetical proteins MTCY159.08c (33.0% identity in 115 aa overlap); Rv1561 and Rv2010. | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1240981 | 1241355 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1144|vapc32
MILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGRGLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
      
    Bibliography
    No article yet recorded