Gene Mb1148
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1148, -, len: 107 aa. Equivalent to Rv1117, len: 107 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 107 aa overlap). Conserved hypothetical protein, some similarity to P94425|D50453 hypothetical protein from Bacillus subtilis (95 aa), fasta scores: opt: 128, E(): 5.1e-06, (28.3% identity in 92 aa overlap); and AL117322|SCF1.02 Streptomyces coelicolor (109 aa), FASTA scores: opt: 437, E(): 1.6e-25, (57.5% identity in 106 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1243004 | 1243327 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1148|Mb1148
MIFIVVKFETKPEWTERWPDLVASFTAATRAEEGNLWFEWSRSLDDPAEYVLVESFRDGEAGGVHVNSDHFRQAMRELPKALASTPKIISQTIDATGWSAMGEMTVG
Bibliography
No article yet recorded