Gene Mb1157c 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved protein | 
| Comments | Mb1157c, -, len: 201 aa. Equivalent to Rv1126c,len: 201 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 201 aa overlap). Conserved hypothetical protein, similar in N-terminus to O05567|MLCB33.17 hypothetical protein from Mycobacterium leprae (141 aa),FASTA scores: opt: 332, E(): 1.4e-23, (58.4% identity in 101 aa overlap). | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1250701 | 1251306 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1157c|Mb1157c
MSELTVLQAVRLKGRVITTDLAQTLGEDLADVAATVDRLTAAGLLVDATPLRISPSGRMRLDDLLAEERNRADSTVLAAAYRDFRSVNADFKRLVTDWQLKGEKPNTHDDAEYDAAVLSRLDGVHRRVGPIIGTVAMQLPRLSRYPVKLRAALDKVKAGDIAWLTRPLIDSYHTVWFELHEELIQAVGLTRDEAAKSGDAQ
      
    Bibliography
    No article yet recorded