Gene Mb1157c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1157c, -, len: 201 aa. Equivalent to Rv1126c,len: 201 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 201 aa overlap). Conserved hypothetical protein, similar in N-terminus to O05567|MLCB33.17 hypothetical protein from Mycobacterium leprae (141 aa),FASTA scores: opt: 332, E(): 1.4e-23, (58.4% identity in 101 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1250701 | 1251306 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1157c|Mb1157c
MSELTVLQAVRLKGRVITTDLAQTLGEDLADVAATVDRLTAAGLLVDATPLRISPSGRMRLDDLLAEERNRADSTVLAAAYRDFRSVNADFKRLVTDWQLKGEKPNTHDDAEYDAAVLSRLDGVHRRVGPIIGTVAMQLPRLSRYPVKLRAALDKVKAGDIAWLTRPLIDSYHTVWFELHEELIQAVGLTRDEAAKSGDAQ
Bibliography
No article yet recorded