Gene Mb1186
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible pyridoxamine 5'-phosphate oxidase (pnp/pmp oxidase) (pyridoxinephosphate oxidase) (pnpox) (pyridoxine 5'-phosphate oxidase) |
| Comments | Mb1186, -, len: 147 aa. Equivalent to Rv1155, len: 147 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 147 aa overlap). Conserved hypothetical protein. Similar to other hypothetical proteins e.g. AL079356|SC6G9.20 Streptomyces coelicolor (144 aa), FASTA scores: opt: 478, E(): 2.8e-26, (55.7% identity in 140 aa overlap); and Mycobacterium tuberculosis proteins Rv1875,Rv0121c, Rv2074. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1282801 | 1283244 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1186|Mb1186
MARQVFDDKLLAVISGNSIGVLATIKHDGRPQLSNVQYHFDPRKLLIQVSIAEPRAKTRNLRRDPRASILVDADDGWSYAVAEGTAQLTPPAAAPDDDTVEALIALYRNIAGEHPDWDDYRQAMVTDRRVLLTLPISHVYGLPPGMR
Bibliography
No article yet recorded