Gene Mb1227
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe13 |
| Comments | Mb1227, PE13, len: 99 aa. Equivalent to Rv1195,len: 99 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 99 aa overlap). Member of Mycobacterium tuberculosis PE family (see first citation below), e.g. Y0DP_MYCTU|Q50615 hypothetical glycine-rich 40.8 kd protein (498 aa), FASTA scores: opt: 307, E(): 1.4e-12,(56.3% identity in 96 aa overlap), similar to MTCY21C12.10c (99 aa), FASTA scores: opt:295, E(): 1.9e-11, (51.5% identity in 97 aa overlap). |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1340253 | 1340552 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1227|PE13
MSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAAS
Bibliography
No article yet recorded