Gene Mb1229 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | esat-6 like protein esxk (esat-6 like protein 3) | 
| Comments | Mb1229, esxK, len: 98 aa. Equivalent to Rv1197,len: 98 aa, from Mycobacterium tuberculosis strain H37Rv,(99.0% identity in 98 aa overlap). esxK, putative ESAT-6 like protein 3. Member of M. tuberculosis hypothetical QILSS protein family with Rv1038c, etc. Almost identical to MTCY98.023c (98 aa) (99.0% identity in 98 aa overlap) and MTCY10G2.11 (98 aa), FASTA scores: opt: 643, E(): 0,(99.0% identity in 98 aa overlap); highly similar to Q49945|U1756C from Mycobacterium leprae (100 aa), FASTA scores: opt: 377, E(): 8e-21, (58.3% identity in 96 aa overlap). BELONGS TO THE ESAT6 FAMILY. | 
| Functional category | Cell wall and cell processes | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1341906 | 1342202 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1229|esxK
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
      
    Bibliography
    No article yet recorded