Gene Mb1229
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esat-6 like protein esxk (esat-6 like protein 3) |
| Comments | Mb1229, esxK, len: 98 aa. Equivalent to Rv1197,len: 98 aa, from Mycobacterium tuberculosis strain H37Rv,(99.0% identity in 98 aa overlap). esxK, putative ESAT-6 like protein 3. Member of M. tuberculosis hypothetical QILSS protein family with Rv1038c, etc. Almost identical to MTCY98.023c (98 aa) (99.0% identity in 98 aa overlap) and MTCY10G2.11 (98 aa), FASTA scores: opt: 643, E(): 0,(99.0% identity in 98 aa overlap); highly similar to Q49945|U1756C from Mycobacterium leprae (100 aa), FASTA scores: opt: 377, E(): 8e-21, (58.3% identity in 96 aa overlap). BELONGS TO THE ESAT6 FAMILY. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1341906 | 1342202 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1229|esxK
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
Bibliography
No article yet recorded