Gene Mb1230
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | putative esat-6 like protein esxl (esat-6 like protein 4) |
Comments | Mb1230, esxL, len: 94 aa. Equivalent to Rv1198,len: 94 aa, from Mycobacterium tuberculosis strain H37Rv,(98.9% identity in 94 aa overlap). esxL, putative ESAT-6 likeprotein 4. Member of the ESAT-6 family with Rv3619c,Rv1037c, etc. Almost identical to MTCY10G2.12 (94 aa) (97.9% identity in 94 aa overlap) and MTCY98.022c (94 aa) (94.7% identity in 94 aa overlap). Highly similar to Q49946|U1756D Mycobacterium leprae (95 aa), FASTA scores: opt: 403, E(): 1.1e-22, (64.1% identity in 92 aa overlap). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1342253 | 1342537 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1230|esxL MTINYQFGDVDDHGAMIRAQAGLLEAEHQAIIRDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
Bibliography
No article yet recorded