Gene Mb1233c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | tetrahydrodipicolinate n-succinyltransferase dapd |
| Comments | Mb1233c, -, len: 317 aa. Equivalent to Rv1201c,len: 317 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 317 aa overlap). Probable transferase (EC 2.-.-.-). Highly similar to Q49948|U1756F Mycobacterium leprae (317 aa), FASTA scores: opt: 1776,E(): 0, (84.9% identity in 317 aa overlap), also Q46064 ORF3 protein from CORYNEBACTERIUM GLUTAMICUM (316 aa),FASTA scores: opt: 864, E(): 0, (44.1% identity in 311 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1345463 | 1346416 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1233c|dapd
MSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHAN
Bibliography
No article yet recorded