Gene Mb1241
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1241, -, len: 122 aa. Equivalent to Rv1209, len: 122 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 122 aa overlap). Conserved hypothetical protein, containing a hydrophobic N-terminus. Similar to Q49956|U1756M hypothetical protein from Mycobacterium leprae (114 aa), FASTA scores: opt: 524, E(): 8.9e-29,(78.6% identity in 112 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1354404 | 1354772 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1241|Mb1241
MALVLVYLVVLVLVAIVLFAAASLLFGRGEQLPPLPRATTATTLPAFGVTRADVDAVKFTQVLRGYKTSEVDWVLERLGRELEALRSQLGAIHASSEDAEAESDASNPSRGETVVHYRSDPA
Bibliography
No article yet recorded