Gene Mb1243
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1243, -, len: 75 aa. Equivalent to Rv1211, len: 75 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 75 aa overlap). Conserved hypothetical protein, similar to Q49958|U1756N Mycobacterium leprae (75 aa), FASTA scores: opt: 460, E(): 0, (90.7% identity in 75 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1355490 | 1355717 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1243|Mb1243
MLGADQARAGGPARIWREHSMAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPDEAAALGDELKGVTS
Bibliography
No article yet recorded