Gene Mb1246c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | pe family protein pe14 |
Comments | Mb1246c, PE14, len: 124 aa. Equivalent to 5' end of Rv1214c, len: 110 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 68 aa overlap). Member of Mycobacterium tuberculosis PE family, appears to be frameshifted but sequence appears to be correct. The 5'-end is atypical as first 9 aa appear to be missing. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, PE14 exists as a single gene. In Mycobacterium bovis, a frameshift due to a 5 bp deletion (cttgt-*) leads to a diffferent COOH terminus. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1358493 | 1358867 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1246c|PE14 MLASAATDLAGIGSALSAANAAAAAPTTAMLAACADEVSAVVASLFARHAQAYQALSLQATAFHQQFVPDRRWRGLCGCRSRQRCCGAERAARRAECDQRSHPGTVRSVTAPMADRAKTAGPGG
Bibliography
No article yet recorded