Gene Mb1254
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | anti-sigma factor rsea |
| Comments | Mb1254, -, len: 154 aa. Equivalent to Rv1222, len: 154 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 154 aa overlap). Conserved hypothetical protein. Identical to O06290|MTU87242 (but shorter due to different start site chosen by proximity of RBS). Equivalent to O05736|U87308|MAU87308_2 hypothetical protein from Mycobacterium avium (133 aa), FASTA scores: opt: 644, E(): 7e-32, (86.2% identity in 109 aa overlap). |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1366586 | 1367050 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1254|rsea
MADPGSVGHVFRRAFSWLPAQFASQSDAPVGAPRQFRSTEHLSIEAIAAFVDGELRMNAHLRAAHHLSLCAQCAAEVDDQSRARAALRDSHPIRIPSTLLGLLSEIPRCPPEGPSKGSSGGSSQGPPDGAAAGFGDRFADGDGGNRGRQSRVRR
Bibliography
No article yet recorded