Gene Mb1266
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE TRANSMEMBRANE PROTEIN |
| Comments | Mb1266, -, len: 175 aa. Equivalent to Rv1234, len: 175 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 175 aa overlap). Possible transmembrane protein with two TM helices. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1378220 | 1378747 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1266|Mb1266
MTSPFQPRQVPGSTPAAAGAGRRGVPALPTPPKGWPVGSYPTYAEAQRAVDYLSEQQFPVQQVTIVGVDLMQVERVTGRLTWPKVLGGGVLSGAWLGLFIGLVLGFFSPNPWSALVTGLVAGVFFGLITSAVPYAMARGTRDFSSTMQLVAGRYDVLCDPQNAEKARDLLARLAI
Bibliography
No article yet recorded