Gene Mb1274 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | possible toxin vapc33. contains pin domain. | 
| Comments | Mb1274, -, len: 143 aa. Equivalent to Rv1242, len: 143 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 143 aa overlap). Conserved hypothetical protein, member of family of 14 hypothetical M. tuberculosis proteins including: Rv2872|Q10800|YS72_MYCTU (147 aa), FASTA scores: opt: 226, E(): 2.7e-09, (32.1% identity in 137 aa overlap); Rv0749, Rv0277c, Rv2530c,etc. | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1385779 | 1386210 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb1274|vapc33
MIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVDLLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
      
    Bibliography
    No article yet recorded