Gene Mb1274
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc33. contains pin domain. |
| Comments | Mb1274, -, len: 143 aa. Equivalent to Rv1242, len: 143 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 143 aa overlap). Conserved hypothetical protein, member of family of 14 hypothetical M. tuberculosis proteins including: Rv2872|Q10800|YS72_MYCTU (147 aa), FASTA scores: opt: 226, E(): 2.7e-09, (32.1% identity in 137 aa overlap); Rv0749, Rv0277c, Rv2530c,etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1385779 | 1386210 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1274|vapc33
MIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVDLLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Bibliography
No article yet recorded