Gene Mb1278c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | toxin rele |
| Comments | Mb1278c, -, len: 97 aa. Equivalent to Rv1246c, len: 97 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 97 aa overlap). Conserved hypothetical protein, highly similar to Rv2866|MTV003.12 hypothetical Mycobacterium tuberculosis protein (87 aa), FASTA scores: opt: 290, E(): 3.9e-24, (54.1% identity in 85 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1389929 | 1390222 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1278c|rele
MSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEIIHIARRSASYRMNPCRPR
Bibliography
No article yet recorded