Gene Mb1287c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable transcriptional regulatory protein |
| Comments | Mb1287c, -, len: 99 aa. Equivalent to 5' end of Rv1257c and 3' end of Rv1255c, len: 455 aa and 202 aa,from Mycobacterium tuberculosis strain H37Rv, (89.5% identity in 57 aa overlap and 83.6% identity in 67 aa overlap). Rv1257c: Probable oxidoreductase (EC 1.-.-.-),similar to e.g. GLCD_ECOLI|P52075 glycolate oxidase subunit glcd (499 aa), FASTA scores: E(): 0, (38.9% identity in 458 aa overlap). Similar to Mycobacterium tuberculosis oxidoreductases e.g. Rv3107c. Rv1255c: Possible regulatory protein, similar to others e.g. ACRR_ECOLI|P34000 potential acrab operon repressor from E. coli (215 aa), FASTA scores: opt: 128, E(): 0.25, (42.1% identity in 57 aa overlap). Helix turn helix motif present at aa 36-57 (+5.48 SD). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 3007 bp deletion (RD13) leads to the fusion of Rv1257c and Rv1255c, and the deletion of Rv1256c, compared to Mycobacterium tuberculosis strain H37Rv. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1404022 | 1404321 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1287c|Mb1287c
MNTDVLAGLMAELPEGMVVTDPAVTDGYRQDRAFDPSAGKPLAIIRPRRARWVVRMLTSLLMFPGRDEADERAMIAEFVVPIVTPASAAARKAGHPGPE
Bibliography
No article yet recorded