Gene Mb1291
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE OXIDOREDUCTASE [SECOND PART] |
| Comments | Mb1291, -, len: 102 aa. Equivalent to 3' end of Rv1260, len: 372 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 102 aa overlap). Probable oxidoreductase (EC 1.-.-.-), highly similar to E1245747|AL021411 putative oxidoreductase SC7H1.18 from Streptomyces coelicolor (397 aa), FASTA scores: E(): 1.4e-29, (45.9% identity in 355 aa overlap); also some similarity to G912582 FAD binding protein homologue from Pseudomonas aeruginosa (286 aa), FASTA scores: opt: 245,E(): 2e-09, (27.5% identity in 251 aa overlap); PCPB_FLASP|P42535 pentachlorophenol 4-monooxygenase (537 aa), FASTA scores: opt: 219, E(): 1.7e-07, (23.3% identity in 360 aa overlap); TETX_BACFR|Q01911 tetracycline resistance protein (388 aa), FASTA scores: opt: 183, E(): 3e-05, (22.8% identity in 373 aa overlap). Also similar to Mycobacterium tuberculosis hypothetical proteins Rv0575c and Rv1751. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv1260 exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base deletion (g-*) splits Rv1260 into 2 parts,Mb1290 and Mb1291. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1407286 | 1407594 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1291|Mb1291
MSQILMDRWSRGRVALVGDAGYCCSPLSGQGTSVALLGAYILAGELKAAGDDYQLGFANYHAEFHGFVERNQWLVSDNIPGGAPIPQEEFERIVHSITIKDY
Bibliography
No article yet recorded