Gene Mb1292c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1292c, -, len: 149 aa. Equivalent to Rv1261c,len: 149 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 149 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv1558|MTCY48.07c (39.2% identity in 125 aa overlap); Rv3547 and Rv3178. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1407720 | 1408169 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1292c|Mb1292c
MDISRWLERHVGVQLLRLHDAIYRGTNGRIGHRIPGAPPSLLLHTTGAKTSQPRTTSLTYARDGDAYLIVASKGGDPRSPGWYHNLKANPDVEINVGPKRFGVTAKPVQPHDPDYARLWQIVNENNANRYTNYQSRTSRPIPVVVLTRR
Bibliography
No article yet recorded