Gene Mb1305
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible lipoprotein lprb |
| Comments | Mb1305, lprB, len: 185 aa. Equivalent to Rv1274,len: 185 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 185 aa overlap). Possible lipoprotein lprB, contains possible N-terminal signal sequence and appropriately positioned prokaryotic lipoprotein lipid attachment site (PS00013) . Some similarity to Rv1275. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1422343 | 1422900 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1305|lprB
MRRKVRRLTLAVSALVALFPAVAGCSDSGDNKPGATIPSTPANAEGRHGPFFPQCGGVSDQTVTELTRVTGLVNTAKNSVGCQWLAGGGILGPHFSFSWYRGSPIGRERKTEELSRASVEDINIDGHSGFIAIGNEPSLGDSLCEVGIQFSDDFIEWSVSFSQKPFPPPCDIAKELTRQSIANSK
Bibliography
No article yet recorded