Gene Mb1306
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible lipoprotein lprc |
| Comments | Mb1306, lprC, len: 180 aa. Equivalent to Rv1275,len: 180 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 180 aa overlap). Possible lipoprotein lprC, contains possible N-terminal signal sequence and appropriately positioned prokaryotic lipoprotein lipid attachment site (PS00013). Some similarity to Rv1274. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1422897 | 1423439 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1306|lprC
MRRVLVGAAALITALLVLTGCTKSISGTAVKAGGAGVPRNNNSQERYPNLLKECEVLTTDILAKTVGADPLDIQSTFVGAICRWQAANPAGLIDITRFWFEQGSLSNERKVAEGLKYQVETRAIQGVDSIVMRTGDPNGACGVASDAAGVVGWWVNPQAPGIDACGQAIKLMELTLATNA
Bibliography
No article yet recorded