Gene Mb1346c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE TRANSPOSASE [FIRST PART] |
| Comments | Mb1346c, -, len: 205 aa. Equivalent to 5' end of Rv1313c, len: 444 aa, from Mycobacterium tuberculosis strain H37Rv, (99.5% identity in 195 aa overlap). Possible IS1557 transposase, similar to several transposases e.g. U57649|DBU57649 ORF1 from dibenzofuran-degrading bacterium DPO360 (163 aa), FASTA scores: opt: 767, E(): 0, (67.3% identity in 168 aa overlap); TNPA_BORPA|Q06126 transposase for insertion sequence element IS1001 from Bordetella parapertussis (406 aa), FASTA scores: opt: 254, E(): 3.3e-10, (24.9% identity in 402 aa overlap). Also similar to putative Mycobacterium tuberculosis transposases,Rv3798 and Rv0741. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv1313c exists as a single gene. In Mycobacterium bovis, a frameshift due to a 12 bp to 1 bp substitution (cttgtcgtggcc-t) splits Rv1313c into 2 parts, Mb1345c and Mb1346c. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1466924 | 1467541 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1346c|Mb1346c
MRNVRLFRALLGVDKRTVIEDIEFEEDDAGDGARVIARVRPRSAVLRRCGRCGRKASWYDRGAGLRQWRSLDWGTVEVFLEAEAPRVNCPTHGPTVVAVPWARHHAGHTYAFDDTVAWLAVACSKTAVCELMRIAWRTVGAIVARVWADTEKRIDRFANLRRIGIDEISYKRHHRYLTVVVDHDSGRLVWAAPSHPGLVLRCPGR
Bibliography
No article yet recorded