Gene Mb1370
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | sulfur carrier protein cyso |
| Comments | Mb1370, -, len: 93 aa. Equivalent to Rv1335, len: 93 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 93 aa overlap). 9.5 kDa culture filtrate antigen cfp10A (see citation below). Similar to hypothetical proteins from other organisms e.g. P74060|D90911 Synechocystis (109 aa), FASTA scores: E(): 2.3e-20, (49.5% identity in 93 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1501138 | 1501419 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1370|cyso
MNVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG
Bibliography
No article yet recorded