Gene Mb1379
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | acyl carrier protein (acp) mbtl |
Comments | Mb1379, -, len: 106 aa. Equivalent to Rv1344, len: 106 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 106 aa overlap). Possible acyl carrier protein, similar to others e.g. ACP_RHIME|P19372 Rhizobium meliloti (77 aa), FASTA scores: opt: 117, E(): 0.03,(29.9% identity in 67 aa overlap) and ACP_SYNY3|P20804 acyl carrier protein (acp) from Synechocystis sp (77 aa),FASTA scores: E(): 7.1e-05, (34.8% identity in 66 aa overlap). Also similar to Rv2244 and Rv0033 from Mycobacterium tuberculosis. |
Functional category | Lipid metabolism |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1507003 | 1507323 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1379|mbtl MWRYPLSTRLALPNTPGVASFAMTSSPSTVSTTLLSILRDDLNIDLTRVTPDARLVDDVGLDSVAFAVGMVAIEERLGVALSEEELLTCDTVGELEAAIAAKYRDE
Bibliography
No article yet recorded