Gene Mb1382c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | lysine n-acetyltransferase mbtk |
| Comments | Mb1382c, -, len: 210 aa. Equivalent to Rv1347c,len: 210 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 210 aa overlap). Conserved hypothetical protein, some similarity to the C-terminus of malonyl-coenzyme A carboxylases e.g. G545170 malonyl-coenzyme A carboxylase (417 aa), FASTA scores: opt: 392, E(): 4.9 e-20, (35.6% identity in 174 aa overlap). |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1510008 | 1510640 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1382c|mbtk
MTKPTSAGQADDALVRLARERFDLPDQVRRLARPPVPSLEPPYGLRVAQLTDAEMLAEWMNRPHLAAAWEYDWPASRWRQHLNAQLEGTYSLPLIGSWHGTDGGYLELYWAAKDLISHYYDADPYDLGLHAAIADLSKVNRGFGPLLLPRIVASVFANEPRCRRIMFDPDHRNTATRRLCEWAGCKFLGEHDTTNRRMALYALEAPTTAA
Bibliography
No article yet recorded