Gene Mb1387
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1387, -, len: 123 aa. Equivalent to Rv1352, len: 123 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 123 aa overlap). Conserved hypothetical protein, some similarity to Rv1906c|MTCY180.12 hypothetical protein from Mycobacterium tuberculosis (156 aa), FASTA scores: E(): 4e-05, (36.2% identity in 116 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1516798 | 1517169 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1387|Mb1387
MARTLALRASAGLVAGMAMAAITLAPGARAETGEQFPGDGVFLVGTDIAPGTYRTEGPSNPLILVFGRVSELSTCSWSTHSAPEVSNENIVDTNTSMGPMSVVIPPTVAAFQTHNCKLWMRIS
Bibliography
No article yet recorded