Gene Mb1403
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | probable conserved lipoprotein lprf |
Comments | Mb1403, lprF, len: 261 aa. Equivalent to Rv1368,len: 261 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 261 aa overlap). Probable lipoprotein lprF, similar to Mycobacterium tuberculosis hypothetical lipoproteins e.g. Rv1270c|Y08C_MYCTU|Q11049 hypothetical 26.4 kd protein cy50.12. (257 aa), FASTA scores: opt: 286,E(): 5.3e-11, (26.3% identity in 270 aa overlap), also Rv1411c|MTCY21B4.28c, (32.8% identity in 253 aa overlap) and Rv2945c. Contains possible N-terminal signal sequence and appropriately positioned prokaryotic lipoprotein lipid attachment site (PS00013). BELONGS TO THE LPPX/LPRAFG FAMILY OF LIPOPROTEINS. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1539055 | 1539840 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1403|lprF MNGLISQACGSHRPRRPSSLGAVAILIAATLFATVVAGCGKKPTTASSPSPGSPSPEAQQILQDSSKATKGLHSVHVVVTVNNLSTLPFESVDADVTNQPQGNGQAVGNAKVRMKPNTPVVATEFLVTNKTMYTKRGGDYVSVGPAEKIYDPGIILDKDRGLGAVVGQVQNPTIQGRDAIDGLATVKVSGTIDAAVIDPIVPQLGKGGGRLPITLWIVDTNASTPAPAANLVRMVIDKDQGNVDITLSNWGAPVTIPNPAG
Bibliography
No article yet recorded