Gene Mb1421
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe15 |
| Comments | Mb1421, PE15, len: 102 aa. Equivalent to Rv1386,len: 102 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 102 aa overlap). Member of Mycobacterium tuberculosis PE family (see first citation below), similar to many e.g. G913039 ORF 3' OF PGRS TANDEM REPEAT (polymorphic GC-rich sequence) (100 aa), FASTA scores: opt: 149, E(): 0.0013, (31.5% identity in 92 aa overlap); also similar to Q49943|U1756A (99 aa) (34.7% identity in 95 aa overlap) and G466937|U1620K (100 aa) (36.2% identity in 69 aa overlap). |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1558143 | 1558451 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1421|PE15
MTLRVVPESLAGASAAIEAVTARLAAAHAAAAPFIAAVIPPGSDSVSVCNAVEFSVHGSQHVAMAAQGVEELGRSGVGVAESGASYAARDALAAASYLSGGL
Bibliography
No article yet recorded