Gene Mb1432c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc10 |
| Comments | Mb1432c, -, len: 133 aa. Equivalent to Rv1397c,len: 133 aa, from Mycobacterium tuberculosis strain H37Rv,(99.2% identity in 133 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis protein MTCY159.08C|Rv2548 (125 aa), FASTA scores: E(): 2.3e-14,(42.4% identity in 125 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1570419 | 1570820 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1432c|vapc10
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRRYRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
Bibliography
No article yet recorded