Gene Mb1433c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb10 |
| Comments | Mb1433c, -, len: 85 aa. Equivalent to Rv1398c, len: 85 aa, from Mycobacterium tuberculosis strain H37Rv, (100% identity in 85 aa overlap). Conserved hypothetical protein, similar to Mycobacterium tuberculosis proteins Rv2547|MTCY159.09C (85 aa), FASTA scores: E(): 0.0035,(37.1% identity in 62 aa overlap); Rv0581, Rv2871, Rv1241,etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1570817 | 1571074 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1433c|vapb10
MKRTNIYLDEEQTASLDKLAAQEGVSRAELIRLLLNRALTTAGDDLASDLQAINDSFGTLRHLDPPVRRSGGREQHLAQVWRATS
Bibliography
No article yet recorded