Gene Mb1446c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved lipoprotein lprg |
| Comments | Mb1446c, lprG, len: 236 aa. Equivalent to Rv1411c,len: 236 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 236 aa overlap). Probable lprG (alternate gene name: P27), conserved lipoprotein, similar to Mycobacterium tuberculosis hypothetical lipoproteins e.g. Rv1270c|MTCY50.12 (35.1% identity in 245 aa overlap); Rv1368, Rv2945c. Contains N-terminal signal sequence and appropriately positioned prokaryotic lipoprotein lipid attachment site (PS00013). Note that the Rv1410c-Rv1411c operon seems transcribed from two promoters in M. bovis BCG (see second citation). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1584079 | 1584789 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1446c|lprG
MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS
Bibliography
No article yet recorded