Gene Mb1451
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE RIBOFLAVIN SYNTHASE BETA CHAIN RIBH (6,7-dimethyl-8-ribityllumazine synthase) (DMRL synthase) (Lumazine synthase) |
| Comments | Mb1451, ribH, len: 154 aa. Equivalent to Rv1416,len: 154 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 154 aa overlap). Probable ribH,riboflavin synthase beta chain (EC 2.5.1.9), similar to many e.g. RISB_ECOLI|P25540 Escherichia coli (156 aa),FASTA scores: opt: 330, E(): 1.8e-15, (44.1% identity in 145 aa overlap). Note alternative GTG start possible overlapping the stop codon of Rv1415|MTCY21B4.33. BELONGS TO THE DMRL SYNTHASE FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1587996 | 1588460 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1451|ribH
MPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
Bibliography
No article yet recorded