Gene Mb1501
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1501, -, len: 115 aa. Equivalent to Rv1466, len: 115 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 115 aa overlap). Conserved hypothetical protein. Equivalent to Z99125|MLCL536.23c hypothetical protein from Mycobacterium leprae (115 aa), FASTA scores: opt: 648, E(): 0, (81.7% identity in 115 aa overlap). Similar to ORF's downstream of sigma factors in Streptococcus mutans and Streptococcus pneumoniae e.g. O06451 ORF3 downstream of RpoD (SPDNAGCPO) (109 aa). Alternative TTG start possible at 13757 then avoids overlap with MTV007.12. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1649977 | 1650324 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1501|Mb1501
MSETSAPAEELLADVEEAMRDVVDPELGINVVDLGLVYGLDVQDGDEGTVALIDMTLTSAACPLTDVIEDQSRSALVGSGLVDDIRINWVWNPPWGPDKITEDGREQLRALGFTV
Bibliography
No article yet recorded